SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043595 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043595
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043595   Gene: ENSCJAG00000003719   Transcript: ENSCJAT00000056730
Sequence length 943
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:125976053:126143870:1 gene:ENSCJAG00000003719 transcript:ENSCJAT00000056730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAIATRTHTGKEDANTVVLDQDKCNIAVE
EEYITDEKKKRKSNQLKEIRRTELKRYYSIDDSQNKTHDKKEKKMVVQKPKGTMEYTAGS
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGERSMTLDPKPTGPLEKSTEPTPT
KPSGGSVSEKLKKLESSRETSSSSPTVTMLSKEPSDTSAAFELTAKENSFLGEDEDFVDL
EELSSQTDGGMDKKDTLKECLSLDPEERKKAELQINNSAMEMQVQSALHFLGTENDVELK
RALDLETCEKQDIMPEVDKQSGSPESQVENTLNIHEDLDKVKLIEYYLNKSKEGSQVSEN
LQKTELSDGKSFEPGGIDITLSSSLSQTGNLLTEGNKEPDKTWVKEREPLLVKLNSSTEE
NVIKEALDSSLKSTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMFL
CIKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDA
KEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEEVLPVLRPP
SALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMD
NQIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGG
RFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFE
Download sequence
Identical sequences F7ILY1
XP_008993241.1.60252 XP_017826862.1.60252 ENSCJAP00000043595 ENSCJAP00000046621 ENSCJAP00000006795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]