SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043687 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043687
Domain Number 1 Region: 207-624
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.69e-94
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00042
Further Details:      
 
Domain Number 2 Region: 69-205
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.63e-37
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043687   Gene: ENSCJAG00000005725   Transcript: ENSCJAT00000058097
Sequence length 691
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:122038738:122081011:-1 gene:ENSCJAG00000005725 transcript:ENSCJAT00000058097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRTPLRKALVGLSKSPKGCARTTATAASNLIEVFVDGQSVMVEPGTTVLQVVAACAMPV
MKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEG
KRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMS
ELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPR
MHEDINEEWISDKTRFAYDGLKRQRLTQPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGK
DVAAIAGGLVDAEALIALKDLLNRVDSDILCTEEVFPTAGAGTDLRSNYLLNTTIAGVEE
ADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALVGSPVDLTYSYDHLGDSPKILQDVA
SGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNIL
HRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVG
APIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPY
DTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYM
TDSISRASQTMAKCVKAVTEGAQAVEEPSIC
Download sequence
Identical sequences F7I330
ENSCJAP00000043687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]