SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043764 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043764
Domain Number 1 Region: 7-441
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.96e-66
Family Acetyl-CoA synthetase-like 0.0000344
Further Details:      
 
Domain Number 2 Region: 653-995
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.67e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0091
Further Details:      
 
Domain Number 3 Region: 453-506
Classification Level Classification E-value
Superfamily ACP-like 0.000012
Family Peptidyl carrier domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043764   Gene: ENSCJAG00000018076   Transcript: ENSCJAT00000063705
Sequence length 997
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:137158943:137202016:1 gene:ENSCJAG00000018076 transcript:ENSCJAT00000063705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKCNLKYILVEKKQINKFKSFHETLNYDTFTVEHNDLVLFRLHWKNTEVDLMLSDGKEK
YEKEKIRNSVSSEHVNEEKVEERMDLRLEHCLAYVLHTSGTTGIPKIVRVPHECIVPNIQ
HFRVLFDITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPTSIKLLPSKLATVLFSH
HRVTVLQATPTLLRRFGSQLIKSTVLSATTSLRVLALGGEVFPSLTVLRSWRGEGNKTQI
FNVYGITEVSSWATIYRIPEKILNSTLKCELPVHLGFPLLGTVVEVRDTNGFTIQEGSGQ
VFLGGRNRVCFLDGEVTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQ
QVAEELQQVESCAVTWYNQEKLILFMVSKDALVKDYIFKELQKHLPSHAIPDELVLIDTL
PFTSHGKIDVSELNKIYLNYINLKSENKLSGKEDLWEKLQYLWKSTLNLPDLLKVPDESR
FLNSGGDSLKSMRLLSEIEKLVGTLVPGLLEMILSSSILEIYNHILQTVFPDEDVTFRKS
CATKRKLSNINQEEASGTSLHQKAIMTLSCHNKINAFVALSRGSQILSLNTTRFLPKLGH
CSSAYPSDSVSQTNTQNLKGLNSPVLIGKSKDPSCVAKVPEEGKPAIGTQKMELHMRWRS
DTGKCVDASPLVVIPSFDESSTTVYIGSHSHKMKAVDFYSGKVKWEQSLGDRIESSACVS
KCGNFIVVGCYNGLVYVLKSNSGEKYWMFTTEDTVKSSPTMDPTTGLIYIGSHDQHAYAL
DIYRKNCVWKSKCGGTVFSSPCLNLIPHHLYCATLGGLLLAVNPATGNVIWKHSCGKPLF
SSPRCCSQYICIGCVDGNLLCFTHFGEQVWQFSTSGPIFSSPCTSPSEQKIFFGSHDCFI
YCCNMKGHLQWKFETTSRVYATPFAFHNYNSSNEMLLAAASTDGKLWILESQSGQLQSVY
ELPGEVFSSPVVLESMLIIGCRNNYVYCLDLLGGNQK
Download sequence
Identical sequences F7IRG8
ENSCJAP00000043764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]