SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043791 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043791
Domain Number 1 Region: 7-261
Classification Level Classification E-value
Superfamily ALDH-like 1.17e-71
Family ALDH-like 0.000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043791   Gene: ENSCJAG00000003697   Transcript: ENSCJAT00000057135
Sequence length 263
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:123450401:123451930:-1 gene:ENSCJAG00000003697 transcript:ENSCJAT00000057135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSAFDSDISELIISQNEINLALKNLQAWMKDTPASTNLFTKLDSAFVRKEPFGLVLIIAP
WNYPINLTLVPLVGALAAGNCVVLKPSEISQGTEKVLAEVLPRYLDQSCFAVVLGGPEET
GQLLKHKFDYIFFTGSPHVGKIVRTAAAKHLTPVTLELGGKNPCYVDDDCDPQIVANRVA
WFRYFIAGQTCVAPDYLLCSPEMQERLLPALQSAITRFYGDDPQSSPNLGRIINQKQFQR
LRALLGCGRVAIGGQSDECDRYI
Download sequence
Identical sequences F7IP29
ENSCJAP00000043791 ENSCJAP00000043791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]