SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043854 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043854
Domain Number 1 Region: 23-129,170-187
Classification Level Classification E-value
Superfamily FKBP-like 2.05e-29
Family FKBP immunophilin/proline isomerase 0.00056
Further Details:      
 
Domain Number 2 Region: 190-256
Classification Level Classification E-value
Superfamily EF-hand 0.000000000116
Family Calbindin D9K 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043854   Gene: ENSCJAG00000021523   Transcript: ENSCJAT00000057457
Sequence length 261
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:39807501:39822906:1 gene:ENSCJAG00000021523 transcript:ENSCJAT00000057457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPETMHFLFRLIVFFYLWGLFTAQRQKIEVNTEEVKIEVLHRPENCSKMSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMMDMCPGEKRKVVIPPSFAYG
KEGYEILEEVFLRQYILVSCHRAPPHVLKCIEVFNLMLKNVYCAEGKIPPDATLIFEIEL
YAVTKGPRSIETFKQIDTDNDRQLSKAEINLYLQRDFEKDKKPRDKSYQDAVLEDIFKKN
DRDGDGFISPKEYNVYQHDEL
Download sequence
Identical sequences F7I7P6
ENSCJAP00000043854 ENSCJAP00000043854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]