SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044017 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044017
Domain Number 1 Region: 80-287
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-20
Family Voltage-gated potassium channels 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044017   Gene: ENSCJAG00000009681   Transcript: ENSCJAT00000060589
Sequence length 374
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:60243344:60254368:1 gene:ENSCJAG00000009681 transcript:ENSCJAT00000060589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEHPYCPLQVSRAQENHMESGEVVAALRACPSVLQSTTHESYGQREEQVLINRQDVMNKE
DAWDVQEFITRMYIKQLLRHPAFQLLLAVLLVVNAITIALRTNSYLDQKHYELFSTIDDI
VLTILICEVLLGWLNGFWIFWKDGWNILNFIIVFELLLGFFINEINIPSINYTLRALRLV
HLCMAVEPLARIIRVILQSVPDLANIMVLILFFMLHFQNMQVALYTLFICITQDGWVDIY
SDFQTEKREYAMEIGGAIYFTIFITIGAFIGINLFIVVVTTNLEQMMKAEEQGQQHQIIF
SKTGAEEEEDENEQLPVVHCVVTRSEKSGLPQEPLVGGPLSNLNENTCDNFCLVLEAIQE
NLTQYKEIRDELNT
Download sequence
Identical sequences F7HHR4
ENSCJAP00000044017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]