SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044151 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044151
Domain Number 1 Region: 71-115
Classification Level Classification E-value
Superfamily LysM domain 0.00000981
Family LysM domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044151   Gene: ENSCJAG00000001004   Transcript: ENSCJAT00000055973
Sequence length 214
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:28877902:28896335:-1 gene:ENSCJAG00000001004 transcript:ENSCJAT00000055973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSPSQSLREGGPCAPRPSAPSPPPRPRSGSESEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQASRKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISEK
PLLFNGLNSIDSPENETVDNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQ
RLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS
Download sequence
Identical sequences F7FYN8
ENSCJAP00000001719 ENSCJAP00000044151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]