SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044165 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044165
Domain Number 1 Region: 92-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.6e-19
Family Complement control module/SCR domain 0.00017
Further Details:      
 
Domain Number 2 Region: 153-221
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-18
Family Complement control module/SCR domain 0.0000155
Further Details:      
 
Domain Number 3 Region: 603-671
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-18
Family Complement control module/SCR domain 0.0000237
Further Details:      
 
Domain Number 4 Region: 542-614
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-18
Family Complement control module/SCR domain 0.0000466
Further Details:      
 
Domain Number 5 Region: 408-476
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 6 Region: 286-349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000082
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 228-291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 350-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000328
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 676-733
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000136
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 10 Region: 32-97
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000958
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 11 Region: 481-552
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000288
Family Complement control module/SCR domain 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044165   Gene: ENSCJAG00000003840   Transcript: ENSCJAT00000059550
Sequence length 734
Comment pep:novel chromosome:C_jacchus3.2.1:19:29518299:29582506:1 gene:ENSCJAG00000003840 transcript:ENSCJAT00000059550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPAPRLPFCCGGTPLAVVVLLALPVAWGQCNAPEQLPFSRPINLTDESQFPIGTYLMY
KCRPGYYGRSFSIVCLKNSVWTSAKDECRRKSCRNPSEPVNGMVHVIKDIKFGSQINYSC
NKGYRLIGSSSATCIASGNTVIWDNEAPVCDIIPCGLPPTIANGDFISTSREDFHYGSVV
TYHCNPGSRGRNMFELVGEPSVYCTSNEDQEGIWSGPAPQCVIPNKCMPPNVENGIMVSH
NRSLFSLNEVVEFRCQPGFVMKGSPRVQCQPLNKWEPELPSCSRVCQPPPDILHGERTQR
DKDSFWPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPAVPRCAVRSCDDFPGQLPNGHVL
FPPNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGR
HTGKPLEVFPFGKAVNYTCDPDPVSGKTFDLVGESTIRCTSDLQGNGIWSSPAPRCGILG
HCKAPGHFLFAKLRTQTNASDFPIGTSLKYECRPEYYGMPFSITCLRNLVWSSPKDVCKR
KSCKTPSDPMNGVVHVMTNIQVGSRINYSCITGYRLVGQSSAECILSGNAAHWSTKPPIC
QEIPCGLPPTITNGYFISTNREYFHYGSVVTYHCNSGSGGRNAFELVGERSIYCTSNEDQ
EGIWSGPAPQCIIPNKCTPPNVENGIMVSGNRSLFSLNEVAEFRCQPGFVMKGSPRVQCQ
PLNKWEPELPSCSR
Download sequence
Identical sequences F7FYC1
ENSCJAP00000044165 ENSCJAP00000006988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]