SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044211 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044211
Domain Number 1 Region: 73-165
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-32
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 2 Region: 19-82
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000000000353
Family Hairpin loop containing domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044211   Gene: ENSCJAG00000004098   Transcript: ENSCJAT00000058829
Sequence length 177
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:25402888:25404925:-1 gene:ENSCJAG00000004098 transcript:ENSCJAT00000058829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRCSGAQSYLLHVEVPGPWQEDVADAEECAGRCGPLLDCRAFHYNVSSHGCQLLPWTQ
HSPHTRLQRSGRCDLFQKKDYIRTCLMDNGVGYRGTVATTSSGLSCQAWSHKFPNDHKYT
PTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCRPYVFGAMARITVARW
Download sequence
Identical sequences F7EED3
ENSCJAP00000044211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]