SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044463 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044463
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 9.34e-85
Family Integrin A (or I) domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.32e-22
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 3 Region: 352-468
Classification Level Classification E-value
Superfamily Integrin domains 2.67e-21
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 4 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000167
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Integrin beta EGF-like domains 0.0034
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Integrin beta EGF-like domains 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000044463
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044463   Gene: ENSCJAG00000013701   Transcript: ENSCJAT00000055652
Sequence length 798
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:29752426:29801735:-1 gene:ENSCJAG00000013701 transcript:ENSCJAT00000055652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWIGLISSVCCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SSNSSNVIQLIIDAYNSLSSEVILENSKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDAFKIRPLGFTEEVEVILQYICECECQSEGIPGSPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECICGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECYPNYTGSACDCSLDTSTCV
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSYFNITKVESREKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEIMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences F6W202
XP_017829669.1.60252 ENSCJAP00000025273 ENSCJAP00000044463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]