SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044806 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044806
Domain Number 1 Region: 5-458
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-150
Family ALDH-like 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044806   Gene: ENSCJAG00000006063   Transcript: ENSCJAT00000056536
Sequence length 460
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:3899599:3938309:-1 gene:ENSCJAG00000006063 transcript:ENSCJAT00000056536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDCGVPEEHAAVRAAYEAFCSWKGVSAKERSSLLRKWYDLMIKNKDDLAKIITAESGKP
LKEAQGEILYSALFLEWFSEEARRVYGDIIYTSARDKRSLVLKQPVGVAAVITPWNFPSA
MITRKVGAALAAGCTVVVKPAEDTPFSALALAEVSCSPLINCCHMFALANQAGIPPGVYN
VIPCSRKNAKEVGEVICTDPLVSKISFTGSTTTGKVLLHHAANSVKRVSMELGGLAPFIV
FDSANVDQAVAGAMASKFRNTGQTCVCSNRFLVQRGIHDAFVKAFAEAMKKNLRVGNGFE
EGTTQGPLINEKAVEKVEKQVNDAVCKGATIVTGGKRHQLGKNFFEPTLLSNVTQDMLCS
HEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEG
LISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
Download sequence
Identical sequences F7ECD4
ENSCJAP00000044806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]