SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044876 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044876
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-28
Family Kringle modules 0.00091
Further Details:      
 
Domain Number 2 Region: 218-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044876   Gene: ENSCJAG00000015398   Transcript: ENSCJAT00000062587
Sequence length 399
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:2979657:2983615:1 gene:ENSCJAG00000015398 transcript:ENSCJAT00000062587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQAAKGFLLLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCH
MPGYLGCFMDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYG
PDRNCSWALGPPGTAVELTFRLFELADSRDRLELRDAASGSLLRAFDGARPPPPGPLRLG
PAALLLTFRSDARGHAQGFALTYRGLLDAAEGPGPPEGSAQTPAAPLNGANVSCSPRPGA
SQAAMGGEAGSRDGRESGSRPLAPILTAAVCPQPGSSRR
Download sequence
Identical sequences F7HGE5
ENSCJAP00000044876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]