SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045035 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045035
Domain Number 1 Region: 299-562
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.14e-87
Family Eukaryotic proteases 0.000000000803
Further Details:      
 
Domain Number 2 Region: 105-211
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-32
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 3 Region: 214-302
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-31
Family Kringle modules 0.0000118
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 5.02e-20
Family Fibronectin type I module 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045035   Gene: ENSCJAG00000007769   Transcript: ENSCJAT00000055581
Sequence length 563
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:40260077:40293246:-1 gene:ENSCJAG00000007769 transcript:ENSCJAT00000055581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTVKTGLCCVLLLCGAVFAWPSQEIHARFRRGARSYRVLCRDEKTQMIYQQHESWLRPV
IRSNRVEYCWCNSGRAQCHSVPIKSCSEPRCFNGGTCRQALYFSDFVCQCPEGFTGKRCE
IDTKATCYEDEGISYRGTWSTAESGAECTNWNSSVLAQKPYSGRRPDAVRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSKGENGDCYFGKGLTYRGTHSLTTSGASCLPW
NSMILIDKVYTAHNPNAQALGLGKHNFCRNPDGDAKPWCHVLKNLRLTWEYCDIPSCSTC
GLRQYNQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCF
QERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSHC
AQESNVVRTVCLPVADLQLPDWTECELSGYGKHEATSPFYSERLKEAHVRLYPSSRCTSQ
HLFNRTVTNNMLCAGDTRSGGPQANLHDACQGDSGGPLVCSKDGRMTLVGIISWGLGCGQ
KDVPGVYTKVTNYLDWIQDNMRP
Download sequence
Identical sequences F6TUX3
XP_008977645.1.60252 XP_008977646.1.60252 ENSCJAP00000045035 ENSCJAP00000014429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]