SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045115 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045115
Domain Number 1 Region: 2-430
Classification Level Classification E-value
Superfamily ALDH-like 1.2e-133
Family ALDH-like 0.00000000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045115   Gene: ENSCJAG00000011784   Transcript: ENSCJAT00000063639
Sequence length 450
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:77143477:77150655:-1 gene:ENSCJAG00000011784 transcript:ENSCJAT00000063639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISETVRRARAAFNSGRTRPLQFRIQQLEALRRMIQEREQELAGALAADLHKSEWTAYYEE
VVYVLEEIEYMIQKLPEWASDEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQ
PMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKELYPVINGGVPETTELLKERFDH
ILYTGSTGVGKIVMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKYMNSGQT
CVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEGQKV
AYGGTGDAASRYIAPTILTDVDPQSPVMQEEIFGPVMPIVCMRSLEDAIQFINQHEKPLA
LYVFSSNDKVIKKMIAETSSGGVTANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFS
HRRSCLVRSLMNDESLKARYPPSPAKMTRH
Download sequence
Identical sequences F6SLB3
ENSCJAP00000045115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]