SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045131 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045131
Domain Number 1 Region: 50-187
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.06e-26
Family 4HBT-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045131   Gene: ENSCJAG00000021481   Transcript: ENSCJAT00000060246
Sequence length 208
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:51915726:51921386:-1 gene:ENSCJAG00000021481 transcript:ENSCJAT00000060246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLLVALLALGLAVFALLDGWYLVRFPGAVLCARLLQPRVRDLLAEQCFAGRVLPSDLD
LLLHMNNARYLREADFARVAHLTRCGVLGALRGLRAHTVLAASCARYRRSLRLLEPFEVR
TRLLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQQLCQRRVEPPELPAD
LQHWISYNEASSQLLRMESGLSDVTKDQ
Download sequence
Identical sequences F7GYU5
ENSCJAP00000039994 ENSCJAP00000045131 XP_002759241.2.60252 ENSCJAP00000039994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]