SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045338 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045338
Domain Number 1 Region: 61-112
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000176
Family Kringle modules 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045338   Gene: ENSCJAG00000010973   Transcript: ENSCJAT00000059919
Sequence length 262
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:194104223:194116673:-1 gene:ENSCJAG00000010973 transcript:ENSCJAT00000059919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQAFLVSNMLLAEAYRSGEAGWPSAPVLGNAAAAGLAGGSRGPGPSPAHVSLSPL
SGAGNHSYCRNPDEDPRGPWCYVSGEAGVPDKRPCEDLSCPETTSQALPASTTETEEVSE
GPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVII
IAIGVGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHTS
QTPLDPQEGSTPLMGQAGTPGA
Download sequence
Identical sequences F6T6N3
ENSCJAP00000045338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]