SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045351 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045351
Domain Number 1 Region: 266-367
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.37e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 120-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 39-95
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000974
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045351   Gene: ENSCJAG00000019202   Transcript: ENSCJAT00000061213
Sequence length 850
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:86717957:86772529:1 gene:ENSCJAG00000019202 transcript:ENSCJAT00000061213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQCWSLGNKFVFLREGLENSKPGELEEIRIENGRISSERRKEKSRDAARSRRSKESEV
FYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKAL
DGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVK
KGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPP
MTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIY
EYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIV
CVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDA
LTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSSNEKLQNINLSMSPLATS
ETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPNSP
SEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRS
FDQLSPLESSSASPESASPQSTVTVFQQTQIQELTSNATTTTATTDELKTVTKDRMEDIK
ILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALS
QRATVPEEELNPKILALQNAQRKRKIEHDGSLFQAVGIGTLLQQPDDHATTTSLSWKRVK
GCKSSEQNGMEQKAIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGE
ELLRALDQVN
Download sequence
Identical sequences F6SVC2
ENSCJAP00000045351 ENSCJAP00000046001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]