SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045473 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045473
Domain Number 1 Region: 103-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.23e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045473   Gene: ENSCJAG00000005199   Transcript: ENSCJAT00000053483
Sequence length 317
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:84804748:84891357:-1 gene:ENSCJAG00000005199 transcript:ENSCJAT00000053483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDHQIIPTLKRSQPAVPSGGPLVQHAHTALDSDAGITENPLTKLLTLGKEDDNAQWHL
SGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERR
RRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLE
QANRRLLLRIQELEIQARTHGLPTLASLGTVDLGAHVTKQQSHPEQNSVDYCQQLTVSQG
PNPELCDQAIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAVS
KESSRRSSLSSDDGDEL
Download sequence
Identical sequences F6Q3Y3
ENSCJAP00000045473 XP_009000982.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]