SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045639 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045639
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily ALDH-like 5.24e-61
Family ALDH-like 0.0000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045639   Gene: ENSCJAG00000011102   Transcript: ENSCJAT00000053463
Sequence length 250
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:79379839:79399454:1 gene:ENSCJAG00000011102 transcript:ENSCJAT00000053463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRSLLEVGGNNAIIAFEDADLNLVVPSALFAAVGTAGQRCTTARRLFVHESIHDEVNRLK
KACTQIRVGNPWDYDSNVLYGPPHTKQAVSMFLGAVEEAKKESGTEVYGGKVMDRPGNYV
EPTMVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFR
WLGPKGSDCGIVNVNIPTSGAEIGGAFGTGKHTGGGRESGSDAWKQYMRRSTCTINYSKD
LPLAQGIKFQ
Download sequence
Identical sequences F6QNR1
ENSCJAP00000045639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]