SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045776 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045776
Domain Number 1 Region: 80-194
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.26e-45
Family P-domain of calnexin/calreticulin 0.000000628
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-31
Family Calnexin/calreticulin 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000045776
Domain Number - Region: 185-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0506
Family Calnexin/calreticulin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045776   Gene: ENSCJAG00000004650   Transcript: ENSCJAT00000058016
Sequence length 296
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:12146931:12151335:1 gene:ENSCJAG00000004650 transcript:ENSCJAT00000058016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNT
YEVKIDNSQVESGSLEDDWDFLPPKKIKDPAASKPEDWDERAKIDDPTDSKPEDWDKPEH
IPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSP
DPNIYTYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQ
DEEQRLKEEEEDKKRKEEEEAEDKDDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Download sequence
Identical sequences F6S6P1
ENSCJAP00000045776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]