SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045969 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045969
Domain Number 1 Region: 126-270,340-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-17
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045969   Gene: ENSCJAG00000006448   Transcript: ENSCJAT00000055424
Sequence length 551
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:52207970:52260567:1 gene:ENSCJAG00000006448 transcript:ENSCJAT00000055424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASLEPKGLVPFTRESFERIQQRIAKTHNEEHEEEDLKPNTDLEVGKELPFTYGNLSRG
MVSEPLEDVDPYYHEKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRGTTIKVLVHPYP
FLLASTLFRLFILISVLTDCIFMSLTNLPKWRPVVENTLLGIYTFEILVKLFARGVWAGS
FSFLGDPWNWLDFSVTVFEIIIRYSPLSFIPMLQTVRTLRILKIIYLNQGLKSLVGVLIC
CVKKLTGVIILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRET
ENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALLALFRLMTQ
DYPEALYHQILYASGKVYMIFFVVVSFWFSFYMASLFLGILAMAHEEEKQRVGETTKNTE
PKFQKTGKELQGGNETAEAKAIQIEMKKRSPASTDTSLDVLEDATLRHKEELEKSKKICP
LCWYKFAETFLIWNCSPCWLKLKEFVHRIITAPFTDLFLFICIILNVSFLALEHYPMSEQ
TSNLLSTGNLV
Download sequence
Identical sequences F6SF33
ENSCJAP00000045969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]