SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045971 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045971
Domain Number 1 Region: 52-270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-72
Family Calnexin/calreticulin 0.0000000327
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.19e-58
Family P-domain of calnexin/calreticulin 0.000000298
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000045971
Domain Number - Region: 401-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000119
Family Calnexin/calreticulin 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045971   Gene: ENSCJAG00000003045   Transcript: ENSCJAT00000056630
Sequence length 610
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:52500691:52555934:1 gene:ENSCJAG00000003045 transcript:ENSCJAT00000056630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFQAFWLCLGLLFISINAEFMDDDVQMEDLEENSEEIDGNEGELSTEIKYKTPQPIGEV
YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQIPGDRGLVLKSRAKHH
AISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYTIMF
GPDKCGEDYKLHFIFRHKHPKTGIFEEKHAKPPDVDLKTFFTDRKTHLYTLVMNPDDTFE
VLVDQTVVNKGSLLEDVVPPINPPKEIEDPSDEKPEEWDERAKIPDPSAVKPEDWDESEP
AQIEDLSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDMDGEWEAPQILNPACRIGCGEWKP
PMIDNPKYKGVWSPPLVDNPNYQGVWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS
DIYFDNFIICSEKEVADHWAADGWRWKIMIANANEPGVLKQLMAATEGHPWLWLIYLVTG
GVPIALITSFCWPRKVKKKYKDTEYKKPDICIPQTKGVLEQEVKEEKAALEKPIDLEEER
KQSDGEMLEKEEEDEPEEKSEEEIEIIEGQEECKKSSKSGSEDEMKEADESTGSGDGLIK
SVRKRRVRKD
Download sequence
Identical sequences F6SEL4
XP_002745381.1.60252 XP_008990926.1.60252 XP_008990927.1.60252 XP_008990929.1.60252 ENSCJAP00000005541 ENSCJAP00000045934 ENSCJAP00000045971 ENSCJAP00000005531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]