SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046068 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000046068
Domain Number - Region: 67-106
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00275
Family RILP dimerisation region 0.009
Further Details:      
 
Domain Number - Region: 212-311
Classification Level Classification E-value
Superfamily Tropomyosin 0.00562
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046068   Gene: ENSCJAG00000034930   Transcript: ENSCJAT00000054561
Sequence length 381
Comment pep:novel chromosome:C_jacchus3.2.1:5:132725777:132728084:-1 gene:ENSCJAG00000034930 transcript:ENSCJAT00000054561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCTLKQENEEKSNVNMLYRKLKEELERKQEQYKEEVKVKQQLELTVQSLEMELKTLRNTP
NQDFHNHEEMKDPMHENGILKGDIAMLREEISTLKNDSLEKENKYFKDLKIIKEINACLE
KSNKLSEEMITKTVSQYRQQLNDLKAGNTSLNSELEKEKENEERLEAEMESYQSRLAAAI
REHNQRMKTERHLNFLYRKHQDVSVQVNTSSELKDKNEFLKEQLSKAQIKFNTLKDNFCK
TRDTLREKTLALETAQNDLSQTQQQIKGMKEMYQNADAKVNKFTGKQNYVEERICELQCK
NLWLKQQLDDAHQKGDNEERVINIQGDFIESGKEGLLLEEKNKKLMNECNYLKERLFQHE
KEKAEVSIKEDKYFQTSGKNV
Download sequence
Identical sequences F6ZB91
ENSCJAP00000046068 ENSCJAP00000046068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]