SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046099 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046099
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.49e-66
Family Aconitase iron-sulfur domain 0.000000000253
Further Details:      
 
Domain Number 2 Region: 276-494
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.94e-52
Family LeuD-like 0.00000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046099   Gene: ENSCJAG00000000971   Transcript: ENSCJAT00000056410
Sequence length 498
Comment pep:novel chromosome:C_jacchus3.2.1:8:22437872:22440288:1 gene:ENSCJAG00000000971 transcript:ENSCJAT00000056410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTICNMGAEIGATTSVFPYNHRMKKYVSKTGRADIANLADEFKDHLVPDPGCHYNQLIE
INLSELKLHINGPFTPELAHPVAEVGKVAEKEGWPVDIEGLIGSCTNSSYEDMGHSAAVA
KQALAHGLQCKSQFTITPGSEQIRATTEWDSCAEVLRDVGGIVLANACGPSIGQWDRKDI
KKGEKNTIVTSYNRNFTGHNDANPETHAFVTTSEIVTALAIAGTLKFNPETDYLMDKDGK
KFKLEAPDADELPKAEFDPGQDTHQHPPQGQQQAVDMSPTSQRLQLLEPFDKWEGKDLED
LQILIKVKGKCTTDHISAAGPWLKFRGHLGNISNSLLIGAINMENGKANSVRNAVTQEFG
PVPDTARYYKKHGLRWVVIRDKNYGEGFSQEHAALEPHHLGSQAIITKSFATIHKTNLKK
QGLLPLTFADPADYKIRPVDKLTIQGLKDFTPGKPLRCIIKHPNGTQETILLNHTFNETQ
IEWFCASSALNRMKELQK
Download sequence
Identical sequences F6YU01
ENSCJAP00000046099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]