SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046285 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046285
Domain Number 1 Region: 397-589
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.53e-58
Family Hemopexin-like domain 0.00000000721
Further Details:      
 
Domain Number 2 Region: 161-218
Classification Level Classification E-value
Superfamily Kringle-like 1.46e-21
Family Fibronectin type II module 0.0000953
Further Details:      
 
Domain Number 3 Region: 256-330
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.32e-21
Family Matrix metalloproteases, catalytic domain 0.00012
Further Details:      
 
Domain Number 4 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 3.92e-18
Family MMP N-terminal domain 0.000019
Further Details:      
 
Domain Number 5 Region: 123-160
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000628
Family Fibronectin type II module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046285   Gene: ENSCJAG00000017207   Transcript: ENSCJAT00000061619
Sequence length 590
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:40064047:40071343:1 gene:ENSCJAG00000017207 transcript:ENSCJAT00000061619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWQPLVLALLALGCCSAAPQRRQPTRVVFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGKFQTFEGDLKWHHHN
ITYWIQNYSACTTDGRSDGVPWCSTTANYDNDGRFGFCPSERLYTQDGNGDGKPCQFPFI
FQGQSYSDCTTDGRSDGYRWCATTSNYDQDKLYGFCPTRADSTVIGGNSAGQPCVFPFTF
LGKEYSSCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSS
VPEALMYPMYRFTEEPPLHKDDVKGIQHLYGSRPEPEPQPPTTTTPQPTAPPTVCPTGPP
TVRPSERPTGPPSAGPTGPPTAGPSAATTVPLDPVDNACNVNIFDAIAEIGNQLYFFKDG
RYWRFSEGRGSRPQGPFPIADTWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGAKVLG
PRRLDKLGLGADVAQVTGALPRGSGKMLLFSGRRVWRFDVKAQMVDPRSASEVYQIFPGV
PLDTHDVFQYREKAYFCQDRFYWRVSSRNEVNQVDQVGYVTYDILQCPED
Download sequence
Identical sequences F7ASP0
ENSCJAP00000046285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]