SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046320 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046320
Domain Number 1 Region: 66-491
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-127
Family ALDH-like 0.00000000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046320   Gene: ENSCJAG00000011784   Transcript: ENSCJAT00000056701
Sequence length 511
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:77143477:77153293:-1 gene:ENSCJAG00000011784 transcript:ENSCJAT00000056701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVQIVPHPAFEYCLFLRKLPGQELQGLNEGWSLNTCPLGSCRSRSPSYQERLCQRHHEPD
QRDREARPRRLQGRTRPLQFRIQQLEALRRMIQEREQELAGALAADLHKSEWTAYYEEVV
YVLEEIEYMIQKLPEWASDEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPM
VGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKAWKELYPVINGGVPETTELLKERFD
HILYTGSTGVGKIVMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKYMNSGQ
TCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEGQK
VAYGGTGDAASRYIAPTILTDVDPQSPVMQEEIFGPVMPIVCMRSLEDAIQFINQHEKPL
ALYVFSSNDKVIKKMIAETSSGGVTANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETF
SHRRSCLVRSLMNDESLKARYPPSPAKMTRH
Download sequence
Identical sequences F6Y9E5
ENSCJAP00000045115 ENSCJAP00000046320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]