SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046389 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046389
Domain Number 1 Region: 72-177
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-34
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-23
Family FKBP immunophilin/proline isomerase 0.001
Further Details:      
 
Domain Number 3 Region: 183-258
Classification Level Classification E-value
Superfamily EF-hand 0.000000000148
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046389   Gene: ENSCJAG00000009141   Transcript: ENSCJAT00000056619
Sequence length 269
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:1038902:1077512:1 gene:ENSCJAG00000009141 transcript:ENSCJAT00000056619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTYDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIHV
IDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLG
SGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLP
EGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNM
FTNQDRNGDGKVIAEEFKLKDQEAKHDEL
Download sequence
Identical sequences F7HZ68
ENSCJAP00000046389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]