SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046740 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046740
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily DNA clamp 9.11e-18
Family DNA polymerase processivity factor 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000046740
Domain Number - Region: 28-130
Classification Level Classification E-value
Superfamily DNA clamp 0.00229
Family DNA polymerase processivity factor 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046740   Gene: ENSCJAG00000018514   Transcript: ENSCJAT00000061960
Sequence length 283
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:168664813:168672174:1 gene:ENSCJAG00000018514 transcript:ENSCJAT00000061960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQQIQDDDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGDGYPLM
LFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESESS
Download sequence
Identical sequences F7I3N9
ENSCJAP00000034355 ENSCJAP00000046740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]