SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047122 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047122
Domain Number 1 Region: 31-75
Classification Level Classification E-value
Superfamily LysM domain 0.00000000523
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047122   Gene: ENSCJAG00000006571   Transcript: ENSCJAT00000057252
Sequence length 504
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:87912336:88009577:-1 gene:ENSCJAG00000006571 transcript:ENSCJAT00000057252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCQRKDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNK
LFSRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFDKTTNPDVHPKETTPS
STLTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKTD
PLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIEIDQLSGRDFCHSKKMTGSN
TQEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQDKSSGASS
ESVQTVNQTEVESLTVKSELTSTPGHLRSDTEHSTNEVGTLSHKTDLNNLEMAIKQGDQV
ADNFQGVSGPKEDSLSIKGNSDQDSFLHENSLHQVENKKENMPCGETTGFKQKQTLNKGK
QGKVQNQNSETEVEELRKLWKTHTMQQTKQQRENIQQVSQKEVKHKITSADGHIESKCYG
VNKVSSSDCMVSLSFLTNAKAAVP
Download sequence
Identical sequences F7HX38
ENSCJAP00000047122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]