SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047464 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047464
Domain Number 1 Region: 108-247
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.38e-37
Family Formate/glycerate dehydrogenases, NAD-domain 0.00097
Further Details:      
 
Domain Number 2 Region: 7-142
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 2.98e-34
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047464   Gene: ENSCJAG00000010474   Transcript: ENSCJAT00000063080
Sequence length 275
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:139319477:139327662:1 gene:ENSCJAG00000010474 transcript:ENSCJAT00000063080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPVQLMKVFVTRRIPPEGRAVLARAADCEVEQWDSDEPIPNEELERGVAGAHGLLCLLS
DRVDKRLLDVAGANLKVISTLSVGVDHLALDEIKKRGIRVGYTPDVLTDATAELAVSLLL
STCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTHSTVGIIGLGRIGQAIARRLKPFGVQRF
LYTGRQPRPEDAAEFQAEFVSTPELAAQSDFIVVACSLTPATKGLCNKDFFQKMKETAVF
VNISRYPGATFPSKSGEEPSPLLPSADFLPHGLLV
Download sequence
Identical sequences F7IFR0
ENSCJAP00000019363 ENSCJAP00000047464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]