SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047563 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047563
Domain Number 1 Region: 367-461
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.07e-36
Family Small-conductance potassium channel 0.00000531
Further Details:      
 
Domain Number 2 Region: 236-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.27e-26
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000047563
Domain Number - Region: 468-526
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.00523
Family Outer membrane efflux proteins (OEP) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047563   Gene: ENSCJAG00000014026   Transcript: ENSCJAT00000058859
Sequence length 543
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:16996590:17051184:1 gene:ENSCJAG00000014026 transcript:ENSCJAT00000058859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSHSYNGGVGRPLGSGPGALGREPPDPEAGCPPQPPHSPGLQVVVAKSEPAVPSPGSRR
GQPQDQDDEEDDEEDEAGGRRGSGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGVVV
MVTETELSWSVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDNQEVTINFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQSRV
RKHQRKFLQAIHQSRRLRSVKIEQGKLNDQANTLTDLAKTQSVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPPDQAARSSPCRWPPVATS
DCG
Download sequence
Identical sequences F7E403
ENSCJAP00000047563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]