SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047608 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047608
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 7.59e-100
Family Iron-containing alcohol dehydrogenase 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047608   Gene: ENSCJAG00000004434   Transcript: ENSCJAT00000055627
Sequence length 467
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:18755188:18792596:1 gene:ENSCJAG00000004434 transcript:ENSCJAT00000055627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAQTRVAHLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGPGV
TKEVGMDLKNMGAKNVCLMTDKNLAQLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDASFM
EAIEFARKGAFDAYVAVGGGSTMDTCKAANLYTSSPHSDFLDYVSAPIGKGKPVSVPLKP
LIAVPTTTGTGSETTGAAIFDYERLKVKTGIASRAIKPTLGLIDPLHTLHMPARVVANSG
FDVLCHALESYTALPYHLRSPCPSNPITRPAYQGSNPISDIWAVHALRIVAKYLKRAVRN
PDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMFPERHLETAEILGADTRSARIQDAGPVLADTLRKFLFDLDVDDGL
AAVGYSKADIPALVKGTLPQERVTKLSPRPQSEEDLAALFEASMKLY
Download sequence
Identical sequences F7H822
ENSCJAP00000047608 XP_002759026.2.60252 ENSCJAP00000008042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]