SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047694 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047694
Domain Number 1 Region: 253-516
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-87
Family Eukaryotic proteases 0.000000000803
Further Details:      
 
Domain Number 2 Region: 59-165
Classification Level Classification E-value
Superfamily Kringle-like 1.72e-32
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 3 Region: 168-256
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-31
Family Kringle modules 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047694   Gene: ENSCJAG00000007769   Transcript: ENSCJAT00000052844
Sequence length 517
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:40260077:40293246:-1 gene:ENSCJAG00000007769 transcript:ENSCJAT00000052844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTVKTGLCCVLLLCGAVFAWPSQEIHARFRRGARSYRGCSEPRCFNGGTCRQALYFSDF
VCQCPEGFTGKRCEIDTKATCYEDEGISYRGTWSTAESGAECTNWNSSVLAQKPYSGRRP
DAVRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSKGENGDCYFGKGLTYRG
THSLTTSGASCLPWNSMILIDKVYTAHNPNAQALGLGKHNFCRNPDGDAKPWCHVLKNLR
LTWEYCDIPSCSTCGLRQYNQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGI
LISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDN
DIALLQLKSDSSHCAQESNVVRTVCLPVADLQLPDWTECELSGYGKHEATSPFYSERLKE
AHVRLYPSSRCTSQHLFNRTVTNNMLCAGDTRSGGPQANLHDACQGDSGGPLVCSKDGRM
TLVGIISWGLGCGQKDVPGVYTKVTNYLDWIQDNMRP
Download sequence
Identical sequences F7GS65
ENSCJAP00000047694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]