SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047725 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047725
Domain Number 1 Region: 54-137
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-34
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 2 Region: 11-52
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-17
Family Kringle modules 0.0017
Further Details:      
 
Domain Number 3 Region: 143-187
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000918
Family Kringle modules 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047725   Gene: ENSCJAG00000004098   Transcript: ENSCJAT00000062464
Sequence length 188
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:25400263:25406582:-1 gene:ENSCJAG00000004098 transcript:ENSCJAT00000062464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWTIRYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAICVWCNGE
DYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQ
LEREFCDLPRCESEAQPRHEATTVSCFRGKGEGYRGTANTTAAGIPCQRWDAQTPHQHRF
VPEKYACK
Download sequence
Identical sequences F7EVL1
ENSCJAP00000047725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]