SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047810 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047810
Domain Number 1 Region: 2-217
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.67e-17
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000047810
Domain Number - Region: 222-289
Classification Level Classification E-value
Superfamily PH0156-like 0.0772
Family PH0156-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047810   Gene: ENSCJAG00000005799   Transcript: ENSCJAT00000061564
Sequence length 325
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:31741397:31796949:1 gene:ENSCJAG00000005799 transcript:ENSCJAT00000061564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICAVGSNAFLTALWTSYDIRYRLFRLLEFSEIFFVSICISELAMKVYVDPTDYWKDGYN
VMDVVIIIIIFLPYTTRRFLGKQFTYLYVADGMQSLRILKIIRYSQGIRMMISAMRQTVY
TVASVLLLLFLLMYIFGILGFCLFGSQDRGDYDNWGNLPVAFFTLFSLATVDGWTDLQKQ
LDNRGFALSRAFTIIFILLASFIFLNMFVGVMIRYTEDSIKKFEQERTLERKMTLMEEKQ
VILQRQQEDISRLMHMQKNADCKSFSELVENFKKTLRHTDPMVLDDFATSLAFIDIYFST
LDYQDMTIHKLQELYYEIAHVLGLV
Download sequence
Identical sequences ENSCJAP00000047810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]