SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047956 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047956
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.47e-79
Family Glutamine synthetase catalytic domain 0.0017
Further Details:      
 
Domain Number 2 Region: 20-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.7e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047956   Gene: ENSCJAG00000004654   Transcript: ENSCJAT00000053228
Sequence length 373
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:23657039:23664232:1 gene:ENSCJAG00000004654 transcript:ENSCJAT00000053228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL
LNETGDEPFQYKN
Download sequence
Identical sequences A0A2K5QE73 A0A2K6V6L3 F7HDF1
ENSCJAP00000008497 ENSCJAP00000047956 ENSCJAP00000050789 XP_003925362.1.74449 XP_010334367.1.74449 XP_017379965.1.71028 XP_017379966.1.71028 XP_017379967.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]