SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048115 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048115
Domain Number 1 Region: 32-117
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.62e-27
Family Ribosomal L11/L12e N-terminal domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 106-177
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000000536
Family Ribosomal protein L11, C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048115   Gene: ENSCJAG00000012027   Transcript: ENSCJAT00000023341
Sequence length 192
Comment pep:novel chromosome:C_jacchus3.2.1:2:186624375:186625435:-1 gene:ENSCJAG00000012027 transcript:ENSCJAT00000023341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSFLCSARKRLRCNFLRSSRIWVHPTPAASTRLLKLNPNEIKVVYLRCTGEVSATSALA
PKISPLGLAPKKVVDDIAKATGDWKGLRITVKLTIQNRQAQVEVVPSASALIMKALKEPP
RDRKKQKIIKHSGNITLDEIVNIAQQIQHPSLARELSGTIREILGTAQSVGHKVDGHHLH
DTNSGVVECPAS
Download sequence
Identical sequences F7HJD4
ENSCJAP00000048115 ENSCJAP00000048115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]