SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048144 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048144
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-21
Family APC10-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048144   Gene: ENSCJAG00000019782   Transcript: ENSCJAT00000060238
Sequence length 167
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:18175566:18177493:-1 gene:ENSCJAG00000019782 transcript:ENSCJAT00000060238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCAETVSRVSSVLNRNTRQFGKKHLFDQNEETCWNSDQGPSQWVTLEFPQLVRVS
QLQIQFQGGFSSHRGCLEGSQGSQALHKIVDFFPEDNNSLQTFPIPVAEVDRLKLTFEDA
TDFFGRVVIYHLRVLGKKGTNRDPYGGQHYRAKLGGRRPHPRNPTSP
Download sequence
Identical sequences F7H8X6
ENSCJAP00000048144 ENSCJAP00000048144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]