SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048237 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048237
Domain Number 1 Region: 1-48,161-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.68e-36
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048237   Gene: ENSCJAG00000020533   Transcript: ENSCJAT00000058261
Sequence length 509
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:38154057:38481491:1 gene:ENSCJAG00000020533 transcript:ENSCJAT00000058261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WNGMMGRAEKGRADLAISAITITPERENVVDFSKRYMDYSVGILIKKPEEKISIFSLFAP
FDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGAFVQQG
GESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYG
TVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGVDNCVSSPSEGIRKAKKGNYAFL
WDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVL
KQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNRC
HQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPTQTLEPTREY
QNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLFRQSP
VKTPIPMSFQPMPGGVLPEALDTSHGTSI
Download sequence
Identical sequences F7EIT5
ENSCJAP00000048237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]