SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048262 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048262
Domain Number 1 Region: 58-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048262   Gene: ENSCJAG00000019266   Transcript: ENSCJAT00000059382
Sequence length 221
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:36959910:36988763:-1 gene:ENSCJAG00000019266 transcript:ENSCJAT00000059382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSS
SSVSDSDERGSMQSLGSDEGYSSASIKRIKLQDSHKACLGL
Download sequence
Identical sequences A0A096N0I0 A0A0D9RRI2 A0A1D5RFG2 A0A2K5DB33 A0A2K5P4B5 A0A2K5RVS1 A0A2K5VD87 A0A2K5YJH7 A0A2K6T441 F7DQU0 G1RGL8 H2P5Y2
ENSPANP00000005765 ENSCJAP00000035765 ENSMMUP00000013390 NP_001247787.1.72884 XP_002757704.1.60252 XP_002811977.1.23681 XP_003262558.1.23891 XP_003922706.1.74449 XP_005575724.1.63531 XP_007968534.1.81039 XP_011840409.1.47321 XP_011895089.1.92194 XP_012289372.1.9421 XP_017377536.1.71028 ENSCJAP00000048262 ENSPPYP00000013752 ENSPPYP00000013752 ENSMMUP00000013390 ENSNLEP00000012368 ENSNLEP00000012368 9544.ENSMMUP00000013390 9600.ENSPPYP00000013752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]