SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048412 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048412
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.57e-94
Family Phosphoglycerate kinase 0.000000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048412   Gene: ENSCJAG00000034433   Transcript: ENSCJAT00000054774
Sequence length 242
Comment pep:novel chromosome:C_jacchus3.2.1:4:141526138:141527577:1 gene:ENSCJAG00000034433 transcript:ENSCJAT00000054774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVAYKIQLINNMLDKVNEMI
IGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEN
AKTGQATVAYGIPAGWMGLDYGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKAL
MDEVVKATSRGCITIIGGGDTATCCARWNTEDKVSHVSTGGGARLELLEGKVLPGVDALS
NI
Download sequence
Identical sequences F7E4X3
ENSCJAP00000048412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]