SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048428 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048428
Domain Number 1 Region: 149-262
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-37
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 257-361
Classification Level Classification E-value
Superfamily FKBP-like 1.18e-33
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 3 Region: 42-146
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-32
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 
Domain Number 4 Region: 367-442
Classification Level Classification E-value
Superfamily EF-hand 0.000000000383
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048428   Gene: ENSCJAG00000009141   Transcript: ENSCJAT00000058612
Sequence length 453
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:1021931:1077575:1 gene:ENSCJAG00000009141 transcript:ENSCJAT00000058612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRARGWRPPPPPLLLLLLWVTGQGAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVR
YHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIAGMCVGEKRIITIPPFLAYGEDGDGKD
IPGQASLVFDVALLDLHNPKDSISIENKVVPKSCERISQSGDFLRYHYNGTLLDGTLFDS
SYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVF
DIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYN
IVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELV
AGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELI
VKNMFTNQDRNGDGKVIAEEFKLKDQEAKHDEL
Download sequence
Identical sequences F7DP70
ENSCJAP00000048428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]