SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048680 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048680
Domain Number 1 Region: 2-541
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.45e-83
Family Acetyl-CoA synthetase-like 0.0000265
Further Details:      
 
Domain Number 2 Region: 722-1063
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0091
Further Details:      
 
Domain Number 3 Region: 553-606
Classification Level Classification E-value
Superfamily ACP-like 0.0000131
Family Peptidyl carrier domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048680   Gene: ENSCJAG00000018076   Transcript: ENSCJAT00000060551
Sequence length 1066
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:137158868:137201967:1 gene:ENSCJAG00000018076 transcript:ENSCJAT00000060551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIDPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLNYDTFTVEHNDLVLFRLHWKNTEVDLMLSDGKEKYEKEKIRNSVSSEHVNEEKV
EERMDLRLEHCLAYVLHTSGTTGIPKIVRVPHECIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSIKLLPSKLATVLFSHHRVTVLQATPTLLRRFGSQL
IKSTVLSATTSLRVLALGGEVFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KILNSTLKCELPVHLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDGEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDALVKDYIFKELQKHLPSHAIPDELVLIDTLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLPDLLKVPDESRFLNSGGDSLKSMRLLSEIEK
LVGTLVPGLLEMILSSSILEIYNHILQTVFPDEDVTFRKSCATKRKLSNINQEEILSLNT
TRFLPKLGHCSSAYPSDSVSQTNTQNLKGLNSPVLIGKSKDPSCVAKVPEEGKPAIGTQK
MELHMRWRSDTGKCVDASPLVVIPSFDESSTTVYIGSHSHKMKAVDFYSGKVKWEQSLGD
RIESSACVSKCGNFIVVGCYNGLVYVLKSNSGEKYWMFTTEDTVKSSPTMDPTTGLIYIG
SHDQHAYALDIYRKNCVWKSKCGGTVFSSPCLNLIPHHLYCATLGGLLLAVNPATGNVIW
KHSCGKPLFSSPRCCSQYICIGCVDGNLLCFTHFGEQVWQFSTSGPIFSSPCTSPSEQKI
FFGSHDCFIYCCNMKGHLQWKFETTSRVYATPFAFHNYNSSNEMLLAAASTDGKLWILES
QSGQLQSVYELPGEVFSSPVVLESMLIIGCRNNYVYCLDLLGGNQK
Download sequence
Identical sequences F6SPD7
ENSCJAP00000048680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]