SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048689 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048689
Domain Number 1 Region: 13-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.52e-38
Family DNA repair glycosylase, N-terminal domain 0.000000277
Further Details:      
 
Domain Number 2 Region: 136-192
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0000000000196
Family DNA repair glycosylase, 2 C-terminal domains 0.0000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048689   Gene: ENSCJAG00000016101   Transcript: ENSCJAT00000059330
Sequence length 195
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:61661228:61680056:1 gene:ENSCJAG00000016101 transcript:ENSCJAT00000059330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARGILPRRLGHRTLASAPAMWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDQSRAGRPTPDELEAVCKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPQLIQLDDVTYHG
FPSLQALAGPSWRCI
Download sequence
Identical sequences F6SP72
ENSCJAP00000048689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]