SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048920 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048920
Domain Number 1 Region: 20-360
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 5.62e-69
Family ADP-ribosylglycohydrolase 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048920   Gene: ENSCJAG00000001719   Transcript: ENSCJAT00000060020
Sequence length 364
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:70462334:70468239:1 gene:ENSCJAG00000001719 transcript:ENSCJAT00000060020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVMAAAGGRGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQNLEP
DPDTPGSQRTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGV
VTVFKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQL
THASSLGYNGAILQALAVHLALQGESSSDHFLQQLVGHMEELEGDAQSVLDARELGMEDR
PYSNRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPNPEIPSAFNS
LQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWRQSCEGYEETDILAQSLHRVF
QKSL
Download sequence
Identical sequences F6QTX9
ENSCJAP00000048920 XP_002750659.1.60252 ENSCJAP00000003079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]