SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048939 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048939
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.15e-21
Family Ribosomal protein L39e 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048939   Gene: ENSCJAG00000034946   Transcript: ENSCJAT00000005342
Sequence length 51
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:8742627:8762494:-1 gene:ENSCJAG00000034946 transcript:ENSCJAT00000005342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHKTFIIKRFLAKKQKQNRPIPQWIQMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences F6QI85
ENSCJAP00000048939 ENSCJAP00000048939 XP_008979615.2.60252 XP_008979617.1.60252 XP_012326281.1.9421 XP_012326282.1.9421 XP_017405057.1.71028 XP_017820245.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]