SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048995 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048995
Domain Number 1 Region: 123-250
Classification Level Classification E-value
Superfamily FKBP-like 1.32e-24
Family FKBP immunophilin/proline isomerase 0.00047
Further Details:      
 
Domain Number 2 Region: 253-380
Classification Level Classification E-value
Superfamily TPR-like 1.18e-23
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048995   Gene: ENSCJAG00000015259   Transcript: ENSCJAT00000060600
Sequence length 440
Comment pep:novel chromosome:C_jacchus3.2.1:22:17537928:17551437:-1 gene:ENSCJAG00000015259 transcript:ENSCJAT00000060600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVGAGRVSESGARPGGAGRASSRPPSSMASCAEPSEPSAPPPAGVPPLEDFEVLDGVED
AEGEEEEEEEEEEEDDLSELPPLEDMGQPLAEEAEQPGALAREFLAAMEPEPAPAPAPEE
WLDILGNGLLRKKTLVPGPPGSSHPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDV
IQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEML
TGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKV
KCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAA
LKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLF
GATAVALGGVALSVVIAARN
Download sequence
Identical sequences F6PKW5
ENSCJAP00000048995 ENSCJAP00000048995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]