SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049079 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049079
Domain Number 1 Region: 174-278
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-32
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 2 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 113-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000587
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049079   Gene: ENSCJAG00000019000   Transcript: ENSCJAT00000059242
Sequence length 280
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:101213359:101246260:1 gene:ENSCJAG00000019000 transcript:ENSCJAT00000059242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMALVGKTAFGFSLMSLFDALDPDWTPDLYDESYEYSDQEETTSSTLA
QPENPDWYYTEDQVDPCEPNPCEHGGDCLVHGSTFTCSCLDPFSGTKCQKVQNRCKDNPC
GRGQCLITQSPPYYRCACKHPYTGPNCSQVVPVCRPNPCQNGGTCSRHKRRSKFTCACPD
QFKGRFCEIGSDDCYVGDGYSYRGKINRTVNQHTCLYWNSHLLLQENYNMFMEDAEAHGI
GEHNFCRNPDADEKPWCFIKVSSDKVKWEYCNVTACSAQA
Download sequence
Identical sequences F6WN60
ENSCJAP00000049079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]