SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049104 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049104
Domain Number 1 Region: 431-660
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-32
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049104   Gene: ENSCJAG00000001712   Transcript: ENSCJAT00000053764
Sequence length 757
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:121723470:121731456:-1 gene:ENSCJAG00000001712 transcript:ENSCJAT00000053764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNLRPKKAQNEADTNNADVFFHSHSSPPYHRPGHGGSHHHHKSHHGVPHHRDESRHPP
EFQDFHGRASSSHVPQSHRHNEARNHGKAHGPTGFGLAPPQGAAPSLHPYAEDYFDGRRL
SDVSQYSGSQQQSDSRYHGGSHHHRRQHNRGENLSRYSSGMSHQGSEASHSDGSYLPHGP
VAYSESFHQNEAFYISGIQPDRTHHRQAHQHGWPHHRQVPQHGRPPHHGEALSHPSFVGI
PDYHGEYRQDDRHPGEHHRDEHPHHSQHHHHQTHQHQDHQHRDHHHGARHSGYLRSDYQY
RDSVQSPSQLSIPRQSPNLIRDALSPGASHAGAFPSHMAHPRGSAHSMVPSGTSIHSHAN
QMSKKLHPQIISTKDSENRGKEEGQSRKRKSDQHQRTHKKGQSTNLLQWLWEKLSHLIQG
FREMIRSLTQSLAFEAFVVFIVCLNTIMLVAQTFAEVEIRGEWYFMALDSIFFCIYVLEA
LLKIFALGLSYFYDFWNNLDFFIMSMAVLDFVLMLTHSFAIYHQNLFRIIKVFKSLRVLR
AIRVLRRLSFLNSVQEVTGTLGQSLPSIAAILILMFTCLLLFSVVLRALFLKSDPKRFQN
IFTTIFTLFTLLTLDDWSLVYMDSRAQGAWYIIPILMIYIIIQYFIFLNLLIAVLVDNFQ
MALLKGSEKVKQEKATWIQKNPLEDSLTELKAAEPKEVLSEGTMLKRLIEKKFGTMTQKQ
QEFLFLYLQLVANVEQHQQQFCSQAAIIDEIVDTTFE
Download sequence
Identical sequences F7CFM8
ENSCJAP00000049104 ENSCJAP00000049104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]