SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049168 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049168
Domain Number 1 Region: 388-444
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.44e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049168   Gene: ENSCJAG00000010678   Transcript: ENSCJAT00000062435
Sequence length 444
Comment pep:novel chromosome:C_jacchus3.2.1:14:59078674:59147229:-1 gene:ENSCJAG00000010678 transcript:ENSCJAT00000062435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYFNPVLWETKVLQSKATEDFFRNSIQSPLFTLQLPHNLHQTLQSSAASLVIPAGRTLP
SFTTAELGTSNSSANFTFPGYSIHVPAGVTLQTASGHLYKVNVPIMVTQTSGRGGILQHP
SQEVFQQLGQPSVIQTSVLQLNPCSLQATTEKSQRIETVLQQPTVLPSGPVDRKHFENTT
TDTLVSPGNEHKIMPEVLMSRQESSHYVSLPSVVFSPQVSQTNSNVESVLSGSASMTQNL
HGGSLSMSSHGVLHQHRTDSHPHILKNRMYGCDSVKQPRNIQEPSNIPVSKKDSNFQVDL
NIQVTDDDINEIIQVDGIGDTSSNEEIGNARDVDENEFLGIIDTGDLKVLEEEADSISNE
DSAATSSDNEDPQVDIVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFY
LKDGVMCFGGRDYVFSKAIGDAEW
Download sequence
Identical sequences F7A139
ENSCJAP00000049168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]